Skip to product information
1 of 1

Gene Bio Systems

Recombinant Inner membrane protein ybhQ(ybhQ)

Recombinant Inner membrane protein ybhQ(ybhQ)

SKU:CSB-CF364567EOD

Regular price ¥264,600 JPY
Regular price Sale price ¥264,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O157:H7

Uniprot NO.:P0AAW7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKWQQRVRVATGLSCWQIMLHLLVVALLVVGWMSKTLVHVGVGLCALYCVTVVMMLVFQR HPEQRWREVADVLEELTTTWYFGAALIVLWLLSRVLENNFLLAIAGLAILAGPAVVSLLA KDKKLHHLTSKHRVRR

Protein Names:Recommended name: Inner membrane protein ybhQ

Gene Names:Name:ybhQ Ordered Locus Names:Z1010, ECs0869

Expression Region:1-136

Sequence Info:full length protein

View full details