Skip to product information
1 of 1

Gene Bio Systems

Recombinant Influenza A virus Matrix protein 2(M)

Recombinant Influenza A virus Matrix protein 2(M)

SKU:CSB-CF718786IBW

Regular price ¥223,000 JPY
Regular price Sale price ¥223,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Influenza A virus (strain A/Chicken/Shantou/4231/2003 H5N1 genotype V)

Uniprot NO.:Q6DPQ1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLLTEVETPTRNEWECRCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTAGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Protein Names:Recommended name: Matrix protein 2 Alternative name(s): Proton channel protein M2

Gene Names:Name:M

Expression Region:1-97

Sequence Info:full length protein

View full details