Skip to product information
1 of 1

Gene Bio Systems

Recombinant Infectious bronchitis virus Spike glycoprotein S1 subunit(S1),partial

Recombinant Infectious bronchitis virus Spike glycoprotein S1 subunit(S1),partial

SKU:CSB-RP182154v

Regular price ¥165,100 JPY
Regular price Sale price ¥165,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: D9IAI3

Gene Names: S1

Organism: Infectious bronchitis virus

AA Sequence: LACQYNTGNFSDGFYPFTNVSLVKERFVVYRETSVNTTLVLTNFTFTNVSNASPNTGGVNTINIYQTQTAQSGYYNFNFSFLSSFVYKQSDFMYGSYHPKCDFRPETINNGLWFNSLSVSLAYGPLQGGCKQSVFSNRATCCYAYSYNGPRLCKGVYIGELPQYFECGLLVYVIKSDGSRIQTRNEPLVLTHYNYNNITLDRCVEYNIYGRSGQGFIINVTASAANYNYLADGGLAILDTSGAIDIFVVQGEYGPNYYKVNPCEDVNQQFVVSGGGIVGVLTSHNETGSQQLENRFYVKLTNSTRRTRRL

Expression Region: 230-539aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 61.7 kDa

Alternative Name(s):

Relevance:

Reference: Characterization of a live attenuated infectious bronchitis virus vaccine candidate derived from the Israeli isolate IS/1494/06.Meir R., Simanov L.

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details