Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Zinc finger matrin-type protein 5(ZMAT5)

Recombinant Human Zinc finger matrin-type protein 5(ZMAT5)

SKU:CSB-EP866211HU

Regular price ¥123,200 JPY
Regular price Sale price ¥123,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: Q9UDW3

Gene Names: ZMAT5

Organism: Homo sapiens (Human)

AA Sequence: MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG

Expression Region: 1-170aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 36 kDa

Alternative Name(s): U11/U12 small nuclear ribonucleoprotein 20KDA protein ;U11/U12 snRNP 20KDA protein ;U11/U12-20K

Relevance:

Reference: Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201).Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.A genome annotation-driven approach to cloning the human ORFeome.Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I.Genome Biol. 5:R84.1-R84.11(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details