Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Vesicle transport protein SFT2C(SFT2D3)

Recombinant Human Vesicle transport protein SFT2C(SFT2D3)

SKU:CSB-CF682329HU

Regular price ¥278,900 JPY
Regular price Sale price ¥278,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q587I9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADLHRQLQEYLAQGKAGGPAAAEPLLAAEKAEEPGDRPAEEWLGRAGLRWTWARSPAES AAAGLTCLPSVTRGQRLAAGGGCLLLAALCFGLAALYAPVLLLRARKFALLWSLGSALAL AGSALLRGGAACGRLLRCEEAPSRPALLYMAALGATLFAALGLRSTLLTVLGAGAQVAAL LAALVGLLPWGGGTALRLALGRLGRGAGLAKVLPV

Protein Names:Recommended name: Vesicle transport protein SFT2C Alternative name(s): SFT2 domain-containing protein 3

Gene Names:Name:SFT2D3

Expression Region:1-215

Sequence Info:full length protein

View full details