Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Vesicle-associated membrane protein-associated protein B-C(VAPB)

Recombinant Human Vesicle-associated membrane protein-associated protein B-C(VAPB)

SKU:CSB-CF025790HU

Regular price ¥279,700 JPY
Regular price Sale price ¥279,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O95292

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL

Protein Names:Recommended name: Vesicle-associated membrane protein-associated protein B/C Short name= VAMP-B/VAMP-C Short name= VAMP-associated protein B/C Short name= VAP-B/VAP-C

Gene Names:Name:VAPB ORF Names:UNQ484/PRO983

Expression Region:2-243

Sequence Info:full length protein

View full details