Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Versican core protein(VCAN),partial

Recombinant Human Versican core protein(VCAN),partial

SKU:CSB-EP025810HU(A5)

Regular price ¥140,000 JPY
Regular price Sale price ¥140,000 JPY
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Signal Transduction

Target / Protein: VCAN

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P13611

AA Sequence: GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Tag info: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

Expression Region: 3089-3354aa

Protein length: Partial

MW: 47.6 kDa

Alternative Name(s): Chondroitin sulfate proteoglycan core protein 2

Relevance: May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.

Reference: "A novel glycosaminoglycan attachment domain identified in two alternative splice variants of human versican." Dours-Zimmermann M.T., Zimmermann D.R. J. Biol. Chem. 269:32992-32998(1994)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details