Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human V-set and transmembrane domain-containing protein 2B(VSTM2B)

Recombinant Human V-set and transmembrane domain-containing protein 2B(VSTM2B)

SKU:CSB-CF025936HU

Regular price ¥282,500 JPY
Regular price Sale price ¥282,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:A6NLU5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AFTEVPKDVTVREGDDIEMPCAFRASGATSYSLEIQWWYLKEPPRELLHELALSVPGARSKVTNKDATKISTVRVQGNDISHRLRLSAVRLQDEGVYECRVSDYSDDDTQEHKAQAMLRVLSRFAPPNMQAAEAVSHIQSSGPRRHGPASAANANNAGAASRTTSEPGRGDKSPPPGSPPAAIDPAVPEAAAASAAHTPTTTVAAAAAASSASPPSGQAVLLRQRHGSGTGRSYTTDPLLSLLLLALHKFLRLLLGH

Protein Names:Recommended name: V-set and transmembrane domain-containing protein 2B

Gene Names:Name:VSTM2B

Expression Region:29-285

Sequence Info:full length protein

View full details