Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Urokinase-type plasminogen activator (PLAU), partial

Recombinant Human Urokinase-type plasminogen activator (PLAU), partial

SKU:P00749

Regular price ¥88,000 JPY
Regular price Sale price ¥88,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cardiovascular

Uniprot ID: P00749

Gene Names: PLAU

Alternative Name(s): ATF; ATF uPA; BDPLT5; Plasminogen activator; Plasminogen activator urinary; Plasminogen activator urokinase; PLAU; QPD; u PA; U plasminogen activator; u-PA; U-plasminogen activator; uPA; URK; UROK_HUMAN; Urokinase plasminogen activator; Urokinase type plasminogen activator; Urokinase type plasminogen activator precursor; Urokinase-type plasminogen activator chain B

Abbreviation: Recombinant Human PLAU protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 21-173aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTL

MW: 21.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.

Reference: "Complete sequencing and characterization of 21,243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36: 40-45(2004)

Function: Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.

View full details