Gene Bio Systems
Recombinant Human Tumor necrosis factor receptor superfamily member 5(CD40)
Recombinant Human Tumor necrosis factor receptor superfamily member 5(CD40)
SKU:CSB-CF004936HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P25942
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Protein Names:Recommended name: Tumor necrosis factor receptor superfamily member 5 Alternative name(s): B-cell surface antigen CD40 Bp50 CD40L receptor CDw40 CD_antigen= CD40
Gene Names:Name:CD40 Synonyms:TNFRSF5
Expression Region:21-277
Sequence Info:full length protein
