Recombinant Human Tumor necrosis factor ligand superfamily member 15(TNFSF15)

SKU: CSB-CF023992HU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O95150

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Protein Names:Recommended name: Tumor necrosis factor ligand superfamily member 15 Alternative name(s): TNF ligand-related molecule 1 Vascular endothelial cell growth inhibitor Cleaved into the following 2 chains: 1. Tumor necrosis factor ligand superfamily member 15, membrane form 2. Tumor necrosis factor ligand superfamily member 15, secreted form

Gene Names:Name:TNFSF15 Synonyms:TL1, VEGI

Expression Region:1-251

Sequence Info:full length protein