Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Transmembrane protein 70, mitochondrial(TMEM70)

Recombinant Human Transmembrane protein 70, mitochondrial(TMEM70)

SKU:CSB-CF883602HU

Regular price ¥271,900 JPY
Regular price Sale price ¥271,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9BUB7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LNTPSDKSEDGRLIYTGNMARAVFGVKCFSYSTSLIGLTFLPYIFTQNNAISESVPLPIQ IIFYGIMGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVK IPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK

Protein Names:Recommended name: Transmembrane protein 70, mitochondrial

Gene Names:Name:TMEM70

Expression Region:82-260

Sequence Info:full length protein

View full details