Recombinant Human  Transmembrane protein 233(TMEM233)

Recombinant Human Transmembrane protein 233(TMEM233)

CSB-CF459503HU
Regular price
¥168,800 JPY
Sale price
¥168,800 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:B4DJY2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSQYAPSPDFKRALDSSPEANTEDDKTEEDVPMPKNYLWLTIVSCFCPAYPINIVALVFS IMSLNSYNDGDYEGARRLGRNAKWVAIASIIIGLLIIGISCAVHFTRNA

Protein Names:Recommended name: Transmembrane protein 233 Alternative name(s): Interferon-induced transmembrane domain-containing protein D2

Gene Names:Name:TMEM233 Synonyms:IFITMD2

Expression Region:1-109

Sequence Info:full length protein

Your list is ready to share