Recombinant Human Transmembrane protease serine 11D(TMPRSS11D)

SKU: CSB-CF023918HU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O60235

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYRPARVTSTSRFLNPYVVCFIVVAGVVILAVTIALLVYFLAFDQKSYFYRSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRAHVAKLRQDGSGVRADVVMKFQFTRNNNGASMKSRIESVLRQMLNNSGNLEINPSTEITSLTDQAAANWLINECGAGPDLITLSEQR

Protein Names:Recommended name: Transmembrane protease serine 11D EC= 3.4.21.- Alternative name(s): Airway trypsin-like protease Cleaved into the following 2 chains: 1. Transmembrane protease serine 11D non-catalytic chain 2. Transmembrane protease serine 11D catalytic chain

Gene Names:Name:TMPRSS11D Synonyms:HAT

Expression Region:1-186

Sequence Info:full length protein