Gene Bio Systems
Recombinant Human Toll-like receptor 7(TLR7),partial
Recombinant Human Toll-like receptor 7(TLR7),partial
SKU:CSB-EP023606HU
Couldn't load pickup availability
Size:20ug. Other sizes are also available. For further information, please contact us.
Research Areas:Epigenetics and Nuclear Signaling
Uniprot ID:Q9NYK1
Gene Names:TLR7
Organism:Homo sapiens (Human)
AA Sequence:HLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTKDPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKYAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALATDNHVAYSQVFKETV
Expression Region:861-1049aa
Sequence Info:Partial
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:29.5 kDa
Alternative Name(s):PRO285; TLR 7; Tlr7; TLR7_HUMAN; Toll like receptor 7; Toll-like receptor 7; UNQ248
Relevance:Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR7 is a nucleotide-sensing TLR which is activated by single-stranded RNA. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
Reference:"Three novel mammalian Toll-like receptors: gene structure, expression, and evolution." Du X., Poltorak A., Wei Y., Beutler B. Eur. Cytokine Netw. 11:362-371(2000)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR7 is a nucleotide-sensing TLR which is activated by single-stranded RNA. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (By similarity).
Involvement in disease:
Subcellular Location:Endoplasmic reticulum membrane, Single-pass type I membrane protein, Endosome, Lysosome, Cytoplasmic vesicle, phagosome
Protein Families:Toll-like receptor family
Tissue Specificity:Detected in brain, placenta, spleen, stomach, small intestine, lung and in plasmacytoid pre-dendritic cells.
Paythway:Toll-likereceptorsignalingpathway
HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:15631
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=659215
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:51284
STRING Database Link:https://string-db.org/network/9606.ENSP00000370034
OMIM Database Link:https://www.omim.org/entry/300365300365300365
Lead Time Guidance:3-7 business days
