Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Thrombopoietin (THPO) (Active)

Recombinant Human Thrombopoietin (THPO) (Active)

SKU:P40225

Regular price ¥74,300 JPY
Regular price Sale price ¥74,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: other

Uniprot ID: P40225

Gene Names: THPO

Alternative Name(s): Thrombopoietin; C-mpl ligand (ML); Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor (MGDF); Myeloproliferative leukemia virus oncogene ligand; THPO; MGDF

Abbreviation: Recombinant Human THPO protein (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 22-353aa

Protein Length: Full Length of Mature Protein

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

MW: 36.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of MO7e cells is 0.4353 - 1.089 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.

Reference: Exome sequencing reveals a thrombopoietin ligand mutation in a Micronesian family with autosomal recessive aplastic anemia. Dasouki M.J., Rafi S.K., Olm-Shipman A.J., Wilson N.R., Abhyankar S., Ganter B., Furness L.M., Fang J., Calado R.T., Saadi I. Blood 122: 3440-3449 (2013)

Function:

View full details