Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Tetraspanin-4(TSPAN4)

Recombinant Human Tetraspanin-4(TSPAN4)

SKU:CSB-CF025162HU

Regular price ¥283,200 JPY
Regular price Sale price ¥283,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O14817

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLSSSFPSLSAANLLIIT GAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATIAILFFAYTDKIDRYAQQDLK KGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLH APGTWWKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTFAMTMYCQVVKADTYCA

Protein Names:Recommended name: Tetraspanin-4 Short name= Tspan-4 Alternative name(s): Novel antigen 2 Short name= NAG-2 Transmembrane 4 superfamily member 7

Gene Names:Name:TSPAN4 Synonyms:NAG2, TM4SF7

Expression Region:1-238

Sequence Info:Full length protein

View full details