
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Epigenetics and Nuclear Signaling
Uniprot ID: O75529
Gene Names: TAF5L
Organism: Homo sapiens (Human)
AA Sequence: MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV
Expression Region: 1-325aa
Sequence Info: Full Length of Isoform 2
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 64 kDa
Alternative Name(s): PCAF-associated factor 65 beta
Relevance: Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex.
Reference: "Histone-like TAFs within the PCAF histone acetylase complex." Ogryzko V.V., Kotani T., Zhang X., Schiltz R.L., Howard T., Yang X.-J., Howard B.H., Qin J., Nakatani Y. Cell 94:35-44(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human DNA-directed RNA polymerase III subunit RPC3(POLR3C)
- Regular price
- ¥82,300 JPY
- Sale price
- ¥82,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human 60KDA SS-A-Ro ribonucleoprotein(TROVE2),partial
- Regular price
- ¥82,300 JPY
- Sale price
- ¥82,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Bifunctional polynucleotide phosphatase-kinase(PNKP)
- Regular price
- ¥82,300 JPY
- Sale price
- ¥82,300 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human POU domain, class 5, transcription factor 1
- Regular price
- ¥82,300 JPY
- Sale price
- ¥82,300 JPY
- Regular price
-
- Unit price
- per
Sold out