
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Immunology
Uniprot NO.:P09564
Uniprot Entry Name:
Gene Names:CD7
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:26-180aa
Sequence:AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
Protein Description:Partial
Tag Info:C-terminal hFc-Myc-tagged
Mol. Weight:46.54
Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 ?g/ml can bind SECTM1 (CSB-MP819898HU), the EC50 is 1.236-1.773 ng/ml.?Human CD7 protein hFc and Myc tag (CSB-MP004953HU) captured on COOH chip can bind Human SECTM1 protein hFc tag (CSB-MP819898HU) with an affinity constant of 1.84 nM as detected by LSPR Assay.
Purity:Greater than 94.5% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:
Relevance:
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human CD276 antigen(CD276),partial (Active)
- Regular price
- ¥54,900 JPY
- Sale price
- ¥54,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Secreted and transmembrane protein 1(SECTM1),partial (Active)
- Regular price
- ¥61,700 JPY
- Sale price
- ¥61,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Programmed cell death 1 ligand 1(CD274),partial (Active)
- Regular price
- ¥46,800 JPY
- Sale price
- ¥46,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human T-cell immunoreceptor with Ig and ITIM domains(TIGIT),partial (Active)
- Regular price
- ¥61,700 JPY
- Sale price
- ¥61,700 JPY
- Regular price
-
- Unit price
- per
Sold out