Gene Bio Systems
Recombinant Human Syndecan-2(SDC2)
Recombinant Human Syndecan-2(SDC2)
SKU:CSB-CF020889HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P34741
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA
Protein Names:Recommended name: Syndecan-2 Short name= SYND2 Alternative name(s): Fibroglycan Heparan sulfate proteoglycan core protein Short name= HSPG CD_antigen= CD362
Gene Names:Name:SDC2 Synonyms:HSPG1
Expression Region:19-201
Sequence Info:full length protein
