Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Synaptotagmin-7(SYT7)

Recombinant Human Synaptotagmin-7(SYT7)

SKU:CSB-CF023043HU

Regular price ¥313,900 JPY
Regular price Sale price ¥313,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O43581

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYRDPEAASPGAPSRDVLLVSAIITVSLSVTVVLCGLCHWCQRKLGKRYKNSLETVGTPDSGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDKLSRNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLKA

Protein Names:Recommended name: Synaptotagmin-7 Alternative name(s): IPCA-7 Prostate cancer-associated protein 7 Synaptotagmin VII Short name= SytVII

Gene Names:Name:SYT7 Synonyms:PCANAP7

Expression Region:1-403

Sequence Info:full length protein

View full details