Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Solute carrier family 22 member 4 (SLC22A4), partial

Recombinant Human Solute carrier family 22 member 4 (SLC22A4), partial

SKU:Q9H015

Regular price ¥104,300 JPY
Regular price Sale price ¥104,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Metabolism

Uniprot ID: Q9H015

Gene Names: SLC22A4

Alternative Name(s): Ergothioneine transporter;ET transporter;Organic cation/carnitine transporter 1

Abbreviation: Recombinant Human SLC22A4 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 42-141aa

Protein Length: Partial

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: LAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK

MW: 18.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Sodium-ion dependent transporter of various organic cationic compounds. A key substrate of this transporter is ergothioneine (ET). Able to transport carnitine, probably moving one sodium ion with one molecule of carnitine. Also transports tetraethylammonium (TEA) without the involvement of sodium.

Reference:

Function:

View full details