Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Sodium-potassium-transporting ATPase subunit beta-2(ATP1B2)

Recombinant Human Sodium-potassium-transporting ATPase subunit beta-2(ATP1B2)

SKU:CSB-CF002327HU

Regular price ¥288,500 JPY
Regular price Sale price ¥288,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P14415

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT

Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-2 Alternative name(s): Sodium/potassium-dependent ATPase subunit beta-2

Gene Names:Name:ATP1B2

Expression Region:1-290

Sequence Info:full length protein

View full details