Gene Bio Systems
Recombinant Human Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 2(NKAIN2)
Recombinant Human Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 2(NKAIN2)
SKU:CSB-CF733165HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q5VXU1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGYCSGRCTLIFICGMQLVCVLERQIFDFLGYQWAPILANFVHIIIVILGLFGTIQYRPR YITGYAVWLVLWVTWNVFVICFYLEAGDLSKETDLILTFNISMHRSWWMENGPGCTVTSV TPAPDWAPEDHRYITVSGCLLEYQYIEVAHSSLQIVLALAGFIYACYVVKCITEEEDSFD FIGGFDSYGYQGPQKTSHLQLQPMYMSK
Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2 Short name= Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 2 Alternative name(s): Protein FAM77B T-cell lymphoma breakpoint-a
Gene Names:Name:NKAIN2 Synonyms:FAM77B, TCBA1
Expression Region:1-208
Sequence Info:full length protein
