Recombinant Human Sialic acid-binding Ig-like lectin 15 (SIGLEC15), partial (Active)

SKU: Q6ZMC9

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cancer

Uniprot ID: Q6ZMC9

Gene Names: SIGLEC15

Alternative Name(s): Sialic acid-binding Ig-like lectin 15; Siglec-15; CD33 antigen-like 3; SIGLEC15; CD33L3

Abbreviation: Recombinant Human SIGLEC15 protein, partial (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 20-263aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-Myc-tagged

Target Protein Sequence: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

MW: 30.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA.Immobilized Human SIGLEC15 at 5 μg/mL can bind Anti-SIGLEC15 recombinant antibody(CSB-RA761623MA3HU). The EC50 is 12.42-16.08 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: /

Reference: Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S. Nat. Genet. 36: 40-45 (2004)

Function: