Recombinant Human Sentrin-specific protease 8(SENP8)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Sentrin-specific protease 8(SENP8)

CSB-EP822251HU
Regular price
¥105,400 JPY
Sale price
¥105,400 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: Q96LD8

Gene Names: SENP8

Organism: Homo sapiens (Human)

AA Sequence: MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK

Expression Region: 1-212aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 40.1 kDa

Alternative Name(s): Deneddylase-1NEDD8-specific protease 1;Protease, cysteine 2Sentrin/SUMO-specific protease SENP8

Relevance: Protease that catalyzes two essential functions in the NEDD8 pathway: processing of full-length NEDD8 to its mature form and deconjugation of NEDD8 from targeted proteins such as cullins or p53.

Reference: Structure of a complex between Nedd8 and the Ulp/Senp protease family member Den1.Reverter D., Wu K., Erdene T.G., Pan Z.-Q., Wilkinson K.D., Lima C.D.J. Mol. Biol. 345:141-151(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human SENP8
    Regular price
    ¥99,500 JPY
    Sale price
    ¥99,500 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human NEDD8(NEDD8)
    Regular price
    ¥105,400 JPY
    Sale price
    ¥105,400 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Cathepsin S(CTSS)
    Regular price
    ¥105,400 JPY
    Sale price
    ¥105,400 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Calpain small subunit 1(CAPNS1)
    Regular price
    ¥105,400 JPY
    Sale price
    ¥105,400 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share