Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Secreted frizzled-related protein 2 (SFRP2), partial

Recombinant Human Secreted frizzled-related protein 2 (SFRP2), partial

SKU:Q96HF1

Regular price ¥121,300 JPY
Regular price Sale price ¥121,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cancer

Uniprot ID: Q96HF1

Gene Names: SFRP2

Alternative Name(s): (FRP-2)(sFRP-2)(Secreted apoptosis-related protein 1)(SARP-1)

Abbreviation: Recombinant Human SFRP2 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 68-186aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-GST-tagged

Target Protein Sequence: TMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIM

MW: 44.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP2 may be important for eye retinal development and for myogenesis.

Reference: "Autocrine/paracrine secreted Frizzled-related protein 2 induces cellular resistance to apoptosis: a possible mechanism of mammary tumorigenesis." Lee J.L., Lin C.T., Chueh L.L., Chang C.J. J Biol Chem 279: 14602-14609(2004)

Function:

View full details