Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human SAYSvFN domain-containing protein 1(SAYSD1)

Recombinant Human SAYSvFN domain-containing protein 1(SAYSD1)

SKU:CSB-CF882064HU

Regular price ¥272,900 JPY
Regular price Sale price ¥272,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9NPB0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEQRLAEFRAARKRAGLAAQPPAASQGAQTPGEKAEAAATLKAAPGWLKRFLVWKPRPAS ARAQPGLVQEAAQPQGSTSETPWNTAIPLPSCWDQSFLTNITFLKVLLWLVLLGLFVELE FGLAYFVLSLFYWMYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPL AGR

Protein Names:Recommended name: SAYSvFN domain-containing protein 1

Gene Names:Name:SAYSD1 Synonyms:C6orf64

Expression Region:1-183

Sequence Info:full length protein

View full details