Recombinant Human Saitohin(STH)

Recombinant Human Saitohin(STH)

CSB-EP022827HU
Regular price
¥82,400 JPY
Sale price
¥82,400 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: Q8IWL8

Gene Names: STH

Organism: Homo sapiens (Human)

AA Sequence: MSEGGGQVSCIFAAPTRLCRWPALIECGVNLTQPLCEWMIQVARDRTLSLAWEVASLLTLSSSEVGLEGVGTIWPSSYSSEESSRNGAEQGRQLSIEGPFQGQNCPSHPAAALPLPMRGESQATSCQV

Expression Region: 1-128aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 29.7 kDa

Alternative Name(s):

Relevance:

Reference: Strong association of the Saitohin gene Q7 variant with progressive supranuclear palsy.de Silva R., Hope A., Pittman A., Weale M.E., Morris H.R., Wood N.W., Lees A.J.Neurology 61:407-409(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share