Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Ryanodine receptor 3(RYR3),partial

Recombinant Human Ryanodine receptor 3(RYR3),partial

SKU:CSB-EP020621HU

Regular price ¥110,000 JPY
Regular price Sale price ¥110,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: Q15413

Gene Names: RYR3

Organism: Homo sapiens (Human)

AA Sequence: DGKGIISKKEFQKAMEGQKQYTQSEIDFLLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQISESDSADRPEEEEEDEDSSYVLEIAGEEEEDGSLEPASAFAMACASVKRNVTDFLKRATLKNLRKQYRNVKKMTAKELV

Expression Region: 3934-4181aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 32.5 kDa

Alternative Name(s): Brain ryanodine receptor-calcium release channelBrain-type ryanodine receptorType 3 ryanodine receptor

Relevance: Calcium channel that mediates the release of Ca2+ from the sarcoplasmic reticulum into the cytoplasm in muscle and thereby plays a role in triggering muscle contraction. May regulate Ca2+ release by other calcium channels. Calcium channel that mediates Ca2+-induced Ca2+ release from the endoplasmic reticulum in non-muscle cells. Contributes to cellular calcium ion homeostasis . Plays a role in cellular calcium signaling.1 Publication

Reference: Characterization of the binding sites for the interactions between FKBP12 and intracellular calcium release channels.Wen H., Kang S., Song Y., Song Y., Yang H.J., Kim M.H., Park S.Arch. Biochem. Biophys. 517:37-42(2012)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details