Recombinant Human RuvB-like 2(RUVBL2)

Recombinant Human RuvB-like 2(RUVBL2)

CSB-EP897459HU
Regular price
¥103,800 JPY
Sale price
¥103,800 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Epigenetics and Nuclear Signaling

Target / Protein: RUVBL2

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: Q9Y230

AA Sequence: ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-463aa

Protein length: Full Length

MW: 67 kDa

Alternative Name(s): 48 kDa TATA box-binding protein-interacting protein Short name: 48 kDa TBP-interacting protein 51 kDa erythrocyte cytosolic protein Short name: ECP-51 INO80 complex subunit J Repressing pontin 52 Short name: Reptin 52 TIP49b TIP60-associated protein 54-beta Short name: TAP54-beta

Relevance: Possesses single-stranded DNA-stimulated ATPase and ATP-dependent DNA helicase (5' to 3') activity; hexamerization is thought to be critical for ATP hydrolysis and adjacent subunits in the ring-like structure contribute to the ATPase activity. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AFZ from the nucleosome. Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair. Plays an essential role in oncogenic transformation by MYC and also modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex. May also inhibit the transcriptional activity of ATF2. Involved in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway where it negatively regulates expression of ER stress response genes.

Reference: "Genome-wide screen identifies a novel p97/CDC-48-dependent pathway regulating ER-stress-induced gene transcription."Marza E., Taouji S., Barroso K., Raymond A.A., Guignard L., Bonneu M., Pallares-Lupon N., Dupuy J.W., Fernandez-Zapico M.E., Rosenbaum J., Palladino F., Dupuy D., Chevet E.EMBO Rep. 16:332-340(2015)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human RuvB-like 2(RUVBL2)
    Regular price
    ¥103,800 JPY
    Sale price
    ¥103,800 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Ribonucleoprotein PTB-binding 2(RAVER2)
    Regular price
    ¥81,100 JPY
    Sale price
    ¥81,100 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Lupus La protein(SSB)
    Regular price
    ¥81,100 JPY
    Sale price
    ¥81,100 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2(NAALADL2),partial
    Regular price
    ¥81,100 JPY
    Sale price
    ¥81,100 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share