Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Ropporin-1B(ROPN1B),partial

Recombinant Human Ropporin-1B(ROPN1B),partial

SKU:CSB-EP020065HU

Regular price ¥109,800 JPY
Regular price Sale price ¥109,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: Q9BZX4

Gene Names: ROPN1B

Organism: Homo sapiens (Human)

AA Sequence: MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE

Expression Region: 1-120aa

Sequence Info: Partial of Isoform 2

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 40.6 kDa

Alternative Name(s): Rhophilin-associated protein 1B

Relevance:

Reference: Identification of sperm-specific proteins that interact with A-kinase anchoring proteins in a manner similar to the type II regulatory subunit of PKA.Carr D.W., Fujita A., Stentz C.L., Liberty G.A., Olson G.E., Narumiya S.J. Biol. Chem. 276:17332-17338(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details