Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Rho guanine nucleotide exchange factor 18(ARHGEF18),partial

Recombinant Human Rho guanine nucleotide exchange factor 18(ARHGEF18),partial

SKU:CSB-EP019681HU

Regular price ¥134,500 JPY
Regular price Sale price ¥134,500 JPY
Sale Sold out
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P08100

Gene Names: ARHGEF18

Organism: Homo sapiens (Human)

AA Sequence: MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQ

Expression Region: 1-36aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 20.2 kDa

Alternative Name(s): Opsin-2

Relevance: Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change leading to G-protein activation and release of all-trans retinal.

Reference: "Isolation and nucleotide sequence of the gene encoding human rhodopsin."Nathans J., Hogness D.S.Proc. Natl. Acad. Sci. U.S.A. 81:4851-4855(1984)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)