Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Retinoic acid receptor responder protein 1(RARRES1)

Recombinant Human Retinoic acid receptor responder protein 1(RARRES1)

SKU:CSB-CF019341HU

Regular price ¥289,200 JPY
Regular price Sale price ¥289,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P49788

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGSGDPDDPGQPQDAGVPRRLLQQAARAALHFFNFRSGSPSALRVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSSYVMWEMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF

Protein Names:Recommended name: Retinoic acid receptor responder protein 1 Alternative name(s): RAR-responsive protein TIG1 Tazarotene-induced gene 1 protein

Gene Names:Name:RARRES1 Synonyms:TIG1

Expression Region:1-294

Sequence Info:full length protein

View full details