Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Receptor activity-modifying protein 2(RAMP2)

Recombinant Human Receptor activity-modifying protein 2(RAMP2)

SKU:CSB-CF019305HU

Regular price ¥258,800 JPY
Regular price Sale price ¥258,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O60895

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA

Protein Names:Recommended name: Receptor activity-modifying protein 2 Alternative name(s): Calcitonin-receptor-like receptor activity-modifying protein 2 Short name= CRLR activity-modifying protein 2

Gene Names:Name:RAMP2

Expression Region:43-175

Sequence Info:full length protein

View full details