Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Ras-related protein Rab-18(RAB18)

Recombinant Human Ras-related protein Rab-18(RAB18)

SKU:CSB-EP878835HU

Regular price ¥109,900 JPY
Regular price Sale price ¥109,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: Q9NP72

Gene Names: RAB18

Organism: Homo sapiens (Human)

AA Sequence: MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYC

Expression Region: 1-206aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 49.7 kDa

Alternative Name(s):

Relevance: Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. Plays a key role in eye and brain development and neurodegeneration.

Reference: "In silico cloning of the human Rab18 gene." Chikri M.M., Boutin M.P., Vaxillaire M.M., Froguel M.P. Submitted (APR-2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details