Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Putative uncharacterized protein PRO1933(PRO1933)

Recombinant Human Putative uncharacterized protein PRO1933(PRO1933)

SKU:CSB-CF863968HU

Regular price ¥262,000 JPY
Regular price Sale price ¥262,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9H354

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNKHNLRLVQLASELILIEIIPKLFLSQVTTISHIKREKIPPNHRKGILCMFPWQCVVYV FSNFVWLVIHRFSNGFIQFLGEPYRLMTASGTHGRIKFMVDIPIIKNTQVLRIPVLKDPK MLSKKH

Protein Names:Recommended name: Putative uncharacterized protein PRO1933

Gene Names:ORF Names:PRO1933

Expression Region:1-126

Sequence Info:full length protein

View full details