Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Putative T-cell surface glycoprotein CD8 beta-2 chain(CD8BP)

Recombinant Human Putative T-cell surface glycoprotein CD8 beta-2 chain(CD8BP)

SKU:CSB-CF004968HU

Regular price ¥270,300 JPY
Regular price Sale price ¥270,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:A6NJW9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:NSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMCIYWLRQRQAPSSDSHHEFLTLWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPVTLGLLVAGVLVLLVSLGVAMHLCCRRRRARLRFMKQLYK

Protein Names:Recommended name: Putative T-cell surface glycoprotein CD8 beta-2 chain Alternative name(s): CD8b pseudogene

Gene Names:Name:CD8BP Synonyms:CD8B2

Expression Region:19-211

Sequence Info:full length protein

View full details