Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Putative neuropeptide Y receptor type 6(NPY6R)

Recombinant Human Putative neuropeptide Y receptor type 6(NPY6R)

SKU:CSB-CF857447HU

Regular price ¥293,000 JPY
Regular price Sale price ¥293,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q99463

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEVSLNHPASNTTSTKNNNSAFFYFESCQPPSPALLLLCIAYTVVLIVGLFGNLSLIIII FKKQRKAQNFTSILIANLSLSDTLVCVMCIHFTIIYTLMDHWIFGDTMCRLTSYVQSVSI SVSIFSLVFTAVERYQLIVNPRGWKPSVTHAYWGITLIWLFSLLLSIPFFLSYHLTDEPF RNLSLPTDLYTHQVACVENWPSKKDRLLFTTSLFLLQYFVPLGFILICYLKIVICLRRRN AKVDKKKENEGRLNENKRINTMLISIVVTFGACWLPRISSMSSLTGIMRC

Protein Names:Recommended name: Putative neuropeptide Y receptor type 6 Short name= NPY6-R Alternative name(s): NPY Y1-like receptor Putative pancreatic polypeptide receptor 2 Short name= PP2

Gene Names:Name:NPY6R Synonyms:NPY1RL, Y2B

Expression Region:1-290

Sequence Info:full length protein

View full details