Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Putative L-type amino acid transporter 1-like protein MLAS(SLC7A5P1)

Recombinant Human Putative L-type amino acid transporter 1-like protein MLAS(SLC7A5P1)

SKU:CSB-CF836603HU

Regular price ¥272,800 JPY
Regular price Sale price ¥272,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q8MH63

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGAGPKRRALAAPVAEEKEEAREKMLASKRADGAAPAGEGEGVTLQRNITLLNGVAIIV GAIIGSGIFVTPTGVLKEAGSPGLALVMWAACGVFSIVGALCYAELGTTISKSGGDYAYM LDVYGSLPAFLKLWIELLVIRPSSQYIVALVFATYLLKPLFPSCPVPEEAAKLMACHCVH

Protein Names:Recommended name: Putative L-type amino acid transporter 1-like protein MLAS Alternative name(s): hLAT1 3-transmembrane protein MLAS Short name= hLAT1 3TM MLAS

Gene Names:Name:SLC7A5P1 Synonyms:MLAS

Expression Region:1-180

Sequence Info:full length protein

View full details