Recombinant Human Pulmonary surfactant-associated protein A2(SFTPA2)

SKU: CSB-CF815565HU

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-20 working days

Research Topic: Others

Uniprot ID: Q8IWL1

Gene Names: SFTPA2

Organism: Homo sapiens(Human)

AA Sequence: EVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPPGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Expression Region: 21-248aa

Sequence Info: Full Length

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

MW: 41.1 kDa

Alternative Name(s): Collectin-5

Relevance: In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration.

Reference: "Isolation and characterization of cDNA clones for the 35-KDA pulmonary surfactant-associated protein."Floros J., Steinbrink R., Jacobs K., Phelps D., Kriz R., Recny M., Sultzman L., Jones S., Taeusch H.W., Frank H.A., Fritsch E.F.J. Biol. Chem. 261:9029-9033(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.