Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Protein FAM19A5(FAM19A5)

Recombinant Human Protein FAM19A5(FAM19A5)

SKU:CSB-CF773595HU

Regular price ¥263,300 JPY
Regular price Sale price ¥263,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q7Z5A7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRT IARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCT QPGGRIKTTTVS

Protein Names:Recommended name: Protein FAM19A5 Alternative name(s): Chemokine-like protein TAFA-5

Gene Names:Name:FAM19A5 Synonyms:TAFA5 ORF Names:UNQ5208/PRO34524

Expression Region:1-132

Sequence Info:full length protein

View full details