Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Protein FAM156A(FAM156A)

Recombinant Human Protein FAM156A(FAM156A)

SKU:CSB-CF847690HU

Regular price ¥270,800 JPY
Regular price Sale price ¥270,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q8NDB6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMMGLSNLSPGPGPSQAVPLPE GLLRQRYREEKTLEERRWERLEFLQRKKAFLRHVRRRHRDHMAPYAVGREARISPLGDRS QNRFRCECRYCQSHRPNLSGIPGESNRAPHPSSWETLVQGLSGLTLSLGTNQPGPLPEAA LQPQETEEKRQRERQQESKIMFQRLLKQWLEEN

Protein Names:Recommended name: Protein FAM156A Alternative name(s): Transmembrane protein 29

Gene Names:Name:FAM156A Synonyms:TMEM29 ORF Names:PP12994, PRO0659 ANDName: FAM156BSynonyms: TMEM29B

Expression Region:1-213

Sequence Info:full length protein

View full details