Gene Bio Systems
Recombinant Human Protein cornichon homolog(CNIH)
Recombinant Human Protein cornichon homolog(CNIH)
SKU:CSB-CF005648HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:O95406
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHA FFCVMFLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGW CKLAFYLLAFFYYLYGMIYVLVSS
Protein Names:Recommended name: Protein cornichon homolog Alternative name(s): T-cell growth-associated molecule 77 Short name= TGAM77
Gene Names:Name:CNIH Synonyms:CNIL ORF Names:UNQ155/PRO181
Expression Region:1-144
Sequence Info:Full length protein
