Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Programmed cell death 1 ligand 2(PDCD1LG2),partial

Recombinant Human Programmed cell death 1 ligand 2(PDCD1LG2),partial

SKU:CSB-EP017667HU

Regular price ¥127,100 JPY
Regular price Sale price ¥127,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Immunology

Uniprot ID:Q9BQ51

Gene Names:PDCD1LG2

Organism:Homo sapiens (Human)

AA Sequence:FTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLK

Expression Region:21-118aa

Sequence Info:Partial

Source:E.coli

Tag Info:N-terminal 6xHis-tagged

MW:15.1 kDa

Alternative Name(s):Butyrophilin B7-DC (B7-DC) (CD_antigen: CD273) (B7DC) (CD273) (PDCD1L2) (PDL2)

Relevance:Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production

Reference:"B7-DC, a new dendritic cell molecule with potent costimulatory properties for T cells." Tseng S.-Y., Otsuji M., Gorski K., Huang X., Slansky J.E., Pai S.I., Shalabi A., Shin T., Pardoll D.M., Tsuchiya H. J. Exp. Med. 193:839-846(2001)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By similarity).

Involvement in disease:

Subcellular Location:Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 2: Endomembrane system, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 1: Cell membrane, Single-pass type I membrane protein

Protein Families:Immunoglobulin superfamily, BTN/MOG family

Tissue Specificity:Highly expressed in heart, placenta, pancreas, lung and liver and weakly expressed in spleen, lymph nodes and thymus.

Paythway:

HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:18731

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=532279

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:80380

STRING Database Link:https://string-db.org/network/9606.ENSP00000380855

OMIM Database Link:https://www.omim.org/entry/605723605723605723

Lead Time Guidance:13-23 business days

View full details