Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Probable N-acetyltransferase 8(NAT8)

Recombinant Human Probable N-acetyltransferase 8(NAT8)

SKU:CSB-CF887033HU

Regular price ¥274,800 JPY
Regular price Sale price ¥274,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9UHE5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSW LLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVG MVGALPVDDPTLREKRLQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTI QLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLPSSKVGSL

Protein Names:Recommended name: Probable N-acetyltransferase 8 EC= 2.3.1.- Alternative name(s): Camello-like protein 1

Gene Names:Name:NAT8 Synonyms:CML1, GLA, TSC501

Expression Region:1-227

Sequence Info:full length protein

View full details