Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Probable low affinity copper uptake protein 2(SLC31A2)

Recombinant Human Probable low affinity copper uptake protein 2(SLC31A2)

SKU:CSB-CF021577HU

Regular price ¥259,600 JPY
Regular price Sale price ¥259,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O15432

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAMHFIFSDTAVLLFDFWSVHSPAGMALSVLVLLLLAVLYEGIKVGKAKLLNQVLVNLPT SISQQTIAETDGDSAGSDSFPVGRTHHRWYLCHFGQSLIHVIQVVIGYFIMLAVMSYNTW IFLGVVLGSAVGYYLAYPLLSTA

Protein Names:Recommended name: Probable low affinity copper uptake protein 2 Alternative name(s): Copper transporter 2 Short name= hCTR2 Solute carrier family 31 member 2

Gene Names:Name:SLC31A2 Synonyms:COPT2, CTR2

Expression Region:1-143

Sequence Info:Full length protein

View full details