
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Epigenetics and Nuclear Signaling
Uniprot ID: O60925
Gene Names: PFDN1
Organism: Homo sapiens (Human)
AA Sequence: AAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ
Expression Region: 2-122
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 41.1 kDa
Alternative Name(s):
Relevance: Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.
Reference: Prefoldin, a chaperone that delivers unfolded proteins to cytosolic chaperonin.Vainberg I.E., Lewis S.A., Rommelaere H., Ampe C., Vandekerckhove J., Klein H.L., Cowan N.J.Cell 93:863-873(1998)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Prefoldin subunit 5(PFDN5)
- Regular price
- ¥81,100 JPY
- Sale price
- ¥81,100 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human p53 and DNA damage-regulated protein 1(PDRG1)
- Regular price
- ¥81,100 JPY
- Sale price
- ¥81,100 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Tubulin-specific chaperone C(TBCC)
- Regular price
- ¥81,100 JPY
- Sale price
- ¥81,100 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Epiplakin(EPPK1) ,partial
- Regular price
- ¥81,100 JPY
- Sale price
- ¥81,100 JPY
- Regular price
-
- Unit price
- per
Sold out