Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Potassium voltage-gated channel subfamily E member 1(KCNE1)

Recombinant Human Potassium voltage-gated channel subfamily E member 1(KCNE1)

SKU:CSB-CF012025HU

Regular price ¥258,100 JPY
Regular price Sale price ¥258,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P15382

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP

Protein Names:Recommended name: Potassium voltage-gated channel subfamily E member 1 Alternative name(s): Delayed rectifier potassium channel subunit IsK IKs producing slow voltage-gated potassium channel subunit beta Mink Minimal potassium channel

Gene Names:Name:KCNE1

Expression Region:1-129

Sequence Info:full length protein

View full details