Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Platelet glycoprotein 4(CD36)

Recombinant Human Platelet glycoprotein 4(CD36)

SKU:CSB-CF004927HU

Regular price ¥322,200 JPY
Regular price Sale price ¥322,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P16671

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK

Protein Names:Recommended name: Platelet glycoprotein 4 Alternative name(s): Fatty acid translocase Short name= FAT Glycoprotein IIIb Short name= GPIIIB Leukocyte differentiation antigen CD36 PAS IV PAS-4 Platelet collagen receptor Platelet glycoprotein IV Short name= GPIV Thrombospondin receptor CD_antigen= CD36

Gene Names:Name:CD36 Synonyms:GP3B, GP4

Expression Region:2-472

Sequence Info:full length protein

View full details